PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000175918
Common NameMYB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 310aa    MW: 34927.2 Da    PI: 9.0678
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000175918genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d ++q+G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000175918 14 KGAWTKEEDQRLIDHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.66.9e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
    MDP0000175918  67 RGNFTQEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.105961IPR017930Myb domain
SMARTSM007176.4E-141363IPR001005SANT/Myb domain
SuperFamilySSF466899.87E-3013108IPR009057Homeodomain-like
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001679.02E-111661No hitNo description
PROSITE profilePS5129429.17662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2865117IPR009057Homeodomain-like
SMARTSM007177.5E-1866114IPR001005SANT/Myb domain
PfamPF002497.0E-1767111IPR001005SANT/Myb domain
CDDcd001673.10E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRAPCCEKA HTNKGAWTKE EDQRLIDHIR QHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TQEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLISRG  120
LDPQTHRPLN QTTTAAAAAT PASRLDLRNR SSPSSAVFDH KTIKNNKFEL LKHPKMEHEY  180
YNYNIESEAN CSTTTGSGTT TDEDQKQQNK YKCSDLNLDL SIGLEPFQSE PTRASSGNSA  240
ESRLQRIIAP SNSNNNHQFF GKVQSTQAVA VAQAVCVCCQ VGFQSSEACS NCQCTSYNGF  300
YRFHRPALNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.142260.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN5447040.0JN544704.1 Malus x domestica MYB transcription factor 3 (MYB3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362465.10.0PREDICTED: transcription repressor MYB6-like
SwissprotP813953e-97MYB30_ANTMA; Myb-related protein 330
TrEMBLJ7F2B80.0J7F2B8_MALDO; MYB transcription factor 3 (Fragment)
STRINGPOPTR_0019s11090.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-90myb domain protein 6